PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.056150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 164aa    MW: 18632.8 Da    PI: 6.9361
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.056150.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY45.81.2e-1421562055
                    S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES- CS
            WRKY 20 fprsYYrCtsagCpvkkkversaedpkvveitYege 55
                      r+YY+C+ +gCpvkk+ver++edpk+v++tYeg+
  Cucsa.056150.1 21 KCRNYYKCSVEGCPVKKRVERDREDPKYVITTYEGQ 56
                    67********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007742.4E-61661IPR003657WRKY domain
SuperFamilySSF1182903.53E-111956IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.9E-132056IPR003657WRKY domain
PfamPF031061.5E-92156IPR003657WRKY domain
PROSITE profilePS5081114.942362IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MKTGLFVLIV NLNWLNQPSV KCRNYYKCSV EGCPVKKRVE RDREDPKYVI TTYEGQSIDQ  60
LQRICRLILW FGITTSGFLL CKLKPDEPEI IPSCISEEML HKMSPVGALV PSDEYWTIAF  120
DLDNGSLKFL PIPLESNQRD PNCCCIVVAQ NCILLGTEFT PKR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818231e-168LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132571e-168LN713257.1 Cucumis melo genomic chromosome, chr_3.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.18e-17WRKY DNA-binding protein 50